missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human BNIP3L (aa 44-176) Control Fragment Recombinant Protein

Code produit 30196158
Change view
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30196158 100 μl 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30196158 Fournisseur Invitrogen™ Code fournisseur RP90045

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82532 (PA5-82532. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that interacts with the small GTPase rab11. A similar protein in rat binds the GTP-containing active form of rab11. This protein may play a role in endosome recycling. Alternate splicing results in multiple transcript variants.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion O60238
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 665
Nom Human BNIP3L (aa 44-176) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène Adenovirus E1B19K-binding protein B5; BCL2 interacting protein 3 like; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 A; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like; BCL2/adenovirus E1B 19 kDa-interacting protein 3-like; BCL2/adenovirus E1B 19-kd protein-interacting protein 3 A; BCL2/adenovirus E1B 19 kDa interacting protein 3 like; BCL2/adenovirus E1B 19 kDa interacting protein 3-like; BCL2/adenovirus E1B 19 kDa-interacting protein 3-like; BCL2/adenovirus E1B 19 kD-interacting protein 3-like; BCL2/adenovirus E1B interacting protein 3-like; BNIP3A; BNIP3H; BNIP3L; C86132; D14Ertd719e; Nip3L; NIP3-like protein X; NIX
Nom usuel BNIP3L
Symbole de gène(s) BNIP3L
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence SNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMK
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.