missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30205367

Invitrogen™ Human BRCAA1 (aa 729-825) Control Fragment Recombinant Protein

Code produit 30205367
Change view
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30205367 100 μl 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30205367 Fournisseur Invitrogen™ Code fournisseur RP93994

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82965 (PA5-82965. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The exact function of C18orf25 remains unknown. There are two named isoforms.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q4LE39
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 51742
Nom Human BRCAA1 (aa 729-825) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 180 kDa Sin3-associated polypeptide; ARID domain-containing protein 4 B; ARID4B; AT rich interactive domain 4 B (Rbp1 like); AT rich interactive domain 4 B (RBP1-like); AT-rich interaction domain 4 B; AT-rich interactive domain-containing protein 4 B; Bcaa; BRCAA1; breast cancer-associated antigen; breast cancer-associated antigen 1; breast cancer-associated antigen BRCAA1; breast carcinoma-associated antigen; histone deacetylase complex subunit SAP180; Rb-binding protein homolog; RBBP1L1; RBP1L1; retinoblastoma binding protein 1-like 1; retinoblastoma-binding protein 1-like 1; retinoblastoma-binding protein 1-related protein; Sap180; SIN3A-associated protein 180; Sin3-associated polypeptide p180
Nom usuel BRCAA1
Symbole de gène(s) ARID4B
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence DNNGKEESKIDHLTNNRNDLISKEEQNSSSLLEENKVHADLVISKPVSKSPERLRKDIEVLSEDTDYEEDEVTKKRKDVKKDTTDKSSKPQIKRGKR
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.