missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30199945

Invitrogen™ Human CCL14 (aa 20-92) Control Fragment Recombinant Protein

Code produit 30199945
Change view
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30199945 100 μl 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30199945 Fournisseur Invitrogen™ Code fournisseur RP95149

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (47%), Rat (47%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56421 (PA5-56421. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene, CCL14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. This gene expresses both monocistronic and bicistronic transcripts. Bicistronic transcripts include the upstream cytokine gene CCL15. In addition, CCL14 undergoes alternative splicing in the bicistronic transcripts; it is unknown if its monocistronic transcript is also subject to alternative splicing.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q16627
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 6358
Nom Human CCL14 (aa 20-92) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène C-C motif chemokine 14; C-C motif chemokine ligand 14; CC-1; CC-3; CCL14; chemokine (C-C motif) ligand 14; chemokine CC-1/CC-3; chemokine CC-3; CKB1; H HCC-1(1-74); HCC-1; HCC-1(1-74); HCC-1(3-74); HCC-1(4-74); HCC-1(9-74); HCC-1/HCC-3; HCC-3; hemofiltrate CC chemokine 1; MCIF; NCC2; NCC-2; new CC chemokine 2; SCYA14; SCYL2; small inducible cytokine subfamily A (Cys-Cys), member 14; small-inducible cytokine A14; SY14
Nom usuel CCL14
Symbole de gène(s) CCL14
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKE
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.