missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human FZD4 (aa 130-215) Control Fragment Recombinant Protein

Code produit 30201002
Change view
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30201002 100 μl 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30201002 Fournisseur Invitrogen™ Code fournisseur RP105592

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FZD4 is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. Frizzled 4 is widely expressed, particularly in heart, skeletal muscle, ovary, and fetal kidney. Transcripts have also been identified in liver, kidney, pancreas, spleen, and fetal lung, and in smaller amounts in placenta, adult lung, prostate, testis, colon, and fetal brain.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q9ULV1
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 8322
Nom Human FZD4 (aa 130-215) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène CD344; CD344 antigen; EVR1; FEVR; frizzled 4, seven transmembrane spanning receptor; frizzled class receptor 4; frizzled family receptor 4; frizzled homolog 4; frizzled homolog 4 (Drosophila); frizzled receptor 4; frizzled-4; Fz4; Fz-4; Fzd4; FZD4S; FzE4; GPCR; hFz4; mFz4; MGC34390; rFz4; WNT receptor frizzled-4
Nom usuel FZD4
Symbole de gène(s) FZD4
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence PVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSA
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.