missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30205175

Invitrogen™ Human Hex (aa 91-163) Control Fragment Recombinant Protein

Code produit 30205175
Change view
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30205175 100 μl 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30205175 Fournisseur Invitrogen™ Code fournisseur RP106635

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HHEX is a member of the homeobox family of transcription factors, many of which are involved in developmental processes. Expression in specific hematopoietic lineages suggests that this protein may play a role in hematopoietic differentiation. Establishes anterior identity at two levels 1) acts early to enhance canonical WNT-signaling by repressing expression of TLE4 and 2) acts later to inhibit NODAL-signaling by directly targeting NODAL.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q03014
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 3087
Nom Human Hex (aa 91-163) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène hematopoietically expressed homeobox; hematopoietically expressed homeobox, related sequence 2; hematopoietically-expressed homeobox protein Hhex; HEX; Hex1; HHEX; Hhex-rs2; HMPH; homeobox; homeobox protein HEX; Homeobox protein PRH; homeobox, hematopoietically expressed; HOX11L-PEN; mHex; Prh; Prhx; proline-rich homeodomain-containing transcription factor
Nom usuel Hex
Symbole de gène(s) HHEX
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence YGPGGFGGPLYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGGQVRFSNDQTIELEKKFETQKYLS
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.