missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30200153

Invitrogen™ Human KCNT2 (aa 957-1012) Control Fragment Recombinant Protein

Code produit 30200153
Change view
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30200153 100 μl 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30200153 Fournisseur Invitrogen™ Code fournisseur RP101419

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62348 (PA5-62348. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Kcnt2 calcium (Ca2+) -activated potassium channels (KCa) are a group of 6/7-TM ion channels that selectively transport K+ ions across biological membranes. KCa channels are broadly classified into three subtypes: SK, IK and BK channels (small, intermediate and big conductance). Kcnt2 is an outward rectifying potassium channel, and produces rapidly activating outward rectifier K(+) currents. Kcnt2 is activated by high intracellular sodium and chloride levels. Further, Kcnt2 channel activity is inhibited by ATP and by inhalation anesthetics, such as isoflurane. Functionally, Kcnt2 is inhibited upon stimulation of G-protein coupled receptors, such as CHRM1 and GRIA1.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q6UVM3
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 343450
Nom Human KCNT2 (aa 957-1012) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène E330038N15Rik; KCa4.2; Kcnt2; Potassium channel subfamily T member 2; potassium channel, sodium activated subfamily T, member 2; potassium channel, sodium-activated subfamily T, member 2; potassium channel, subfamily T, member 2; potassium sodium-activated channel subfamily T member 2; sequence like an intermediate conductance potassium channel subunit; SLICK; SLO2.1; sodium- and chloride-activated ATP-sensitive potassium channel; sodium and chloride-activated ATP-sensitive potassium channel Slo2.1; sodium- and chloride-activated ATP-sensitive potassium channel subunit; sodium-and chloride-activated ATP-sensitive potassium channel (SLICK)
Nom usuel KCNT2
Symbole de gène(s) Kcnt2
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence GIYRTESQKLTTSESQISISVEEWEDTKDSKEQGHHRSNHRNSTSSDQSDHPLLRR
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.