missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30196051

Invitrogen™ Human KCNV1 (aa 128-202) Control Fragment Recombinant Protein

Code produit 30196051
Change view
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30196051 100 μl 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30196051 Fournisseur Invitrogen™ Code fournisseur RP110121

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144946 (PA5-144946. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium voltage-gated channel subfamily V. This protein is essentially present in the brain, and its role might be to inhibit the function of a particular class of outward rectifier potassium channel types.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q6PIU1
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 27012
Nom Human KCNV1 (aa 128-202) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 2700023A03Rik; HNKA; KCNB3; KCNV1; KV2.3; kv2.3 r; Kv8.1; neuronal potassium channel alpha subunit; neuronal potassium channel alpha subunit HNKA; potassium channel Kv8.1; potassium channel Kv8.1 homolog; potassium channel, subfamily V, member 1; potassium channel, voltage gated modifier subfamily V, member 1; potassium channel, voltage-gated modifier subfamily V, member 1; potassium voltage-gated channel modifier subfamily V member 1; potassium voltage-gated channel subfamily V member 1; vibe; Voltage-gated potassium channel subunit Kv2.3 r; voltage-gated potassium channel subunit Kv8.1
Nom usuel KCNV1
Symbole de gène(s) KCNV1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence LCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDFKKDTEDQESQHESEQDFSQGPCPTVRQKLWNILEK
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.