missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human LAMP1 (aa 211-339) Control Fragment Recombinant Protein

Code produit 30209562
Change view
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30209562 100 μl 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30209562 Fournisseur Invitrogen™ Code fournisseur RP90558

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LAMP1 (CD107a, lysosome-associated membrane protein-1) together with LAMP-2, is a major constituent of lysosomal membrane, 1-2% of total CD107a is found also on the plasma membrane. LAMP1 is a heavily glycosylated membrane protein which contains a putative signal peptide, 18 sites for N-linked glycosylation, a single membrane-spanning segment and a short (11 amino acid) cytosolic tail. The LAMP proteins are involved in lysosome biogenesis and are required for fusion of lysosomes with phagosomes. LAMP1 is a type 1 integral membrane protein that is transported from trans-Golgi network to endosomes and then lysosomes. Upon cell activation, LAMP1 transfer to the plasma membrane is dependent on a carboyxl-terminal tyrosine based motif (YXXI). Perturbation in the spacing between the tyrosine based motif relative to the membrane abolishes lysosome localization of LAMP1, and this mutant protein then cycles between the plasma membrane and the endosome. Cell surface LAMP1 (and LAMP2) have been shown to promote adhesion of human peripheral blood mononuclear cells (PBMC) to vascular endothelium, therefore, they are possibly involved in the adhesion of PBMC to the site of inflammation. Increased LAMP1 immunoreactivity is observed in neurons and glial cells surrounding senile plaques in Alzheimer’s Disease (AD) cases, and is localized in medullary epithelial cells, single macrophages and lymphocytes in acute thymic involution. LAMP1 is a good marker of mast cell activation.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P11279
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 3916
Nom Human LAMP1 (aa 211-339) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 120 kDa lysosomal membrane glycoprotein; AI196048; CD107 antigen-like family member A; CD107a; I79_011073; Lamp I; LAMP1; LAMP-1; LAMPA; LGP120; LGP-120; LGPA; LGP-A; lysosomal associated membrane protein 1; Lysosomal associated membrane protein 1 (120 kDa); lysosomal membrane glycoprotein 1; lysosomal membrane glycoprotein A; lysosomal-associated membrane protein 1; lysosome-associated membrane glycoprotein 1; LYSOSOME-ASSOCIATED MEMBRANE GLYCOPROTEIN 1 PRECURSOR (LAMP-1) (LGP-A) (LGP-120) (CD107A) (P2B); lysosome-associated membrane protein 1; P2B
Nom usuel LAMP1 (CD107a)
Symbole de gène(s) LAMP1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence SPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCN
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.