missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MMP26 Partial ORF (NP_068573, 152 a.a. - 261 a.a.) Recombinant Protein with GST-tag at N-terminal

Code produit 16142213
Change view
Click to view available options
Quantité:
10 μg
25 μg
Conditionnement:
10µg
25µg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
16142213 10 μg 10µg
16152213 25 μg 25µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 16142213 Fournisseur Abnova™ Code fournisseur H00056547Q01.10ug

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Used for AP, Array, ELISA, WB-Re

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The encoded protein degrades type IV collagen, fibronectin, fibrinogen, casein, vitronectin, alpha 1-antitrypsin, alpha 2-macroglobulin, and insulin-like growth factor-binding protein 1, and activates MMP9 by cleavage. The protein differs from most MMP family members in that it lacks a conserved C-terminal protein domain. [provided by RefSeq]

Sequence: SFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP

Spécification

Numéro d’adhésion NP_068573
À utiliser avec (application) Antibody Production, ELISA, Protein Array, Western Blot
Formule 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Identification génétique (Entrez) 56547
Poids moléculaire 37.84kDa
Nom MMP26 (Human) Recombinant Protein (Q01)
Test du contrôle qualité 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantité 10 μg
Immunogène SFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP
Conditions de stockage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
État réglementaire RUO
Alias de gène MGC126590/MGC126592
Nom usuel MMP26
Symbole de gène(s) MMP26
Espèces Wheat Germ (in vitro)
Recombinant Recombinant
Marqueur de protéine GST
Système d’expression wheat germ expression system
Forme Liquid
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.