missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30199673

Invitrogen™ Human MRGPRF Control Fragment Recombinant Protein

Code produit 30199673
Change view
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30199673 100 μl 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30199673 Fournisseur Invitrogen™ Code fournisseur RP95172

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110966. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May bind to a neuropeptide and may regulate nociceptor function and/or development, including the sensation or modulation of pain. Expressed in the Gut, vas deferens, uterus and aorta; barely detectable in liver, kidney, lung, and salivary gland. In the brain, markedly abundant in the cerebellum.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q96AM1
Concentration 3.10 mg/mL
À utiliser avec (application) Neutralization, Control
Formule PBS, 1M urea with no preservative; pH 7.4
Identification génétique (Entrez) 116535
Nom Human MRGPRF Control Fragment
Plage de pH 7.4
Méthode de purification Purified
Quantité 100 μl
Conditions de stockage -20°C, Avoid Freeze/Thaw Cycles
État réglementaire RUO
Alias de gène BC019711; G protein coupled receptor (RTA); G protein coupled receptor Rca; G protein-coupled receptor 140; G protein-coupled receptor 168; G protein-coupled receptor MrgF; G protein-coupled receptor RTA; G-p; GPR140; GPR168; G-protein coupled receptor 140; G-protein coupled receptor 168; G-protein coupled receptor RTA; MAS related GPR family member F; mas-related G protein-coupled MRGF; Mas-related G protein-coupled receptor c; mas-related gene; mas-related gene F protein; MAS-related GPR, member F; mas-related G-protein coupled receptor member F; MAS-related G-protein coupled receptor, member F; MGC21621; Mgrc; MRGF; MRGPRF; PSEC0142; Rta; seven transmembrane helix receptor
Nom usuel MRGPRF
Symbole de gène(s) MRGPRF
Type de produit Protein
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence MAGNCSWEAHPGNRNRMCPGLSEAPELYSRGFLTIEQIAMLP
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.