missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30203125

Invitrogen™ Human MRP1 (aa 226-317) Control Fragment Recombinant Protein

Code produit 30203125
Change view
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Quantité unitSize
30203125 100 μl 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 missing translation for 'options'
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30203125 missing translation for 'mfr' Invitrogen™ missing translation for 'supplierNo' RP109526

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutathione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternative splicing by exon deletion results in several splice variants but maintains the original open reading frame in all forms.
TRUSTED_SUSTAINABILITY

Specifikationer

Numéro d’adhésion P33527
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 4363
Nom Human MRP1 (aa 226-317) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène ABC29; ABCC; Abcc1; Abcc1a; Abcc1b; ATP binding cassette subfamily C member 1; ATP-binding cassette sub-family C (CFTR/MRP) member 1 A; ATP-binding cassette sub-family C member 1; ATP-binding cassette transporter variant ABCC1delta-e x 13; ATP-binding cassette transporter variant ABCC1delta-e x 13&14; ATP-binding cassette transporter variant ABCC1delta-e x 25; ATP-binding cassette transporter variant ABCC1delta-e x 25&26; ATP-binding cassette, subfamily C (CFTR/MRP), member 1; ATP-binding cassette, sub-family C (CFTR/MRP), member 1; ATP-binding cassette, sub-family C (CFTR/MRP), member 1 A; ATP-binding cassette, sub-family C (CFTR/MRP), member 1 b; Avcc1a; DKFZp686N04233; DKFZp781G125; Glutathione-S-conjugate-translocating ATPase ABCC1; GS-X; leuk; leukotriene C(4) transporter; LTC4 transporter; Mdrap; MRP; Mrp1; multidrug resistance protein 1; multidrug resistance-associated protein 1; multiple drug resistance-associated protein
Nom usuel MRP1
Symbole de gène(s) ABCC1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence GLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVL
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.