Learn More
Abnova™ Human NAB2 Partial ORF (NP_005958.1, 421 a.a. - 525 a.a.) Recombinant Protein with GST-tag at N-terminal
Description
This gene encodes a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo- or hetero-multimerize with other EGR or NAB proteins through a conserved N-terminal domain, and repress transcription through two partially redundant C-terminal domains. Transcriptional repression by the encoded protein is mediated in part by interactions with the nucleosome remodeling and deactylase (NuRD) complex. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq]
Spécification
Spécification
| Numéro d’adhésion | NP_005958.1 |
| À utiliser avec (application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formule | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Identification génétique (Entrez) | 4665 |
| Poids moléculaire | 37.29kDa |
| Nom | NAB2 (Human) Recombinant Protein (Q01) |
| Test du contrôle qualité | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quantité | 25 ug |
| Immunogène | DGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLVSHDRVGRLSPCVPAKPPLAEFEEGLLDRCPAPGPHPALVEGRRSSVKVEAEASRQ |
| Conditions de stockage | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Afficher plus |
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.