missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human NCLN Partial ORF (NP_064555, 44 a.a. - 144 a.a.) Recombinant Protein with GST-tag at N-terminal
Description
Sequence: HEFTVYRMQQYDLQGQPYGTRNAVLNTEARTMAAEVLSRRCVLMRLLDFSYEQYQKALRQSAGAVVIILPRAMAAVPQDVVRQFMEIEPEMLAMETAVPVY
Spécification
Spécification
| Numéro d’adhésion | NP_064555 |
| À utiliser avec (application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formule | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Identification génétique (Entrez) | 56926 |
| Poids moléculaire | 36.85kDa |
| Nom | NCLN (Human) Recombinant Protein (Q01) |
| Test du contrôle qualité | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quantité | 10 μg |
| Immunogène | HEFTVYRMQQYDLQGQPYGTRNAVLNTEARTMAAEVLSRRCVLMRLLDFSYEQYQKALRQSAGAVVIILPRAMAAVPQDVVRQFMEIEPEMLAMETAVPVY |
| Conditions de stockage | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?