missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30204063

Invitrogen™ Human NSG2 (aa 111-171) Control Fragment Recombinant Protein

Código de producto. 30204063
Change view
Click to view available options
Quantité:
100 μl
Tamaño de la unidad:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Quantité unitSize
30204063 100 μl 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30204063 Proveedor Invitrogen™ N.º de proveedor RP96576

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63263 (PA5-63263. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NSG2 is a protein coding gene. Gene ontology (GO) annotation include cytoplasmic vesicle membrane; dendrite; early endosome; early endosome membrane; endosome; Golgi apparatus; Golgi cis cisterna membrane; integral component of membrane; late endosome; lysosomal lumen; multivesicular body membrane; trans-Golgi network membrane.
TRUSTED_SUSTAINABILITY

Especificaciones

Numéro d’adhésion Q9Y328
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 51617
Nom Human NSG2 (aa 111-171) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène CALY3; HMP19; HMP19 protein; hypothalamus golgi apparatus expressed 19 kDa protein; neuron specific gene family member 2; Neuronal vesicle trafficking-associated protein 2; neuron-specific protein family member 2; NSG2; p19 protein; protein 8.5; Protein p19
Nom usuel NSG2
Symbole de gène(s) NSG2
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence RCIPASLDAYYSSQDPNSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEPKPPKTQGH
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.