missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PCNA (aa 80-163) Control Fragment Recombinant Protein

Code produit 30196280
Change view
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30196280 100 μl 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30196280 Fournisseur Invitrogen™ Code fournisseur RP95287

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111000 (PA5-111000. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PCNA (polymerase delta auxiliary protein) is essential for DNA replication and is involved in DNA excision and mismatch repair pathways. PCNA binds to the CDK inhibitor p21, the structure-specific endonucleases Fen1 and XPG, and DNA cytosine 5-methyltransferase (MCMT). PCNA is a potentially useful marker of cells with proliferative potential and for identifying the proliferation status of tumor tissue (i.e. relevant to prognosis). PCNA is a marker for cells in early G1 phase and S phase of the cell cycle. PCNA is found in the nucleus and is a cofactor of DNA polymerase delta, and acts as a homotrimer and helps increase the processing of leading strand synthesis during DNA replication. In response to DNA damage, PCNA is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for PCNA. Pseudogenes of PCNA have been described on chromosome 4 and on the X chromosome.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P12004
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 5111
Nom Human PCNA (aa 80-163) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène ATLD2; cb16; Cyclin; DNA polymerase delta auxiliary protein; etID36690.10; fa28e03; fb36g03; HGCN8729; hypothetical protein LOC515499; MGC8367; Pcna; pcna protein; Pcna/cyclin; PCNAR; POL30; Proliferating cell nuclear antigen; wu:fa28e03; wu:fb36g03; YBR0811; YBR088C
Nom usuel PCNA
Symbole de gène(s) Pcna
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence KCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCA
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.