missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PDP2 (aa 416-486) Control Fragment Recombinant Protein

Code produit 30198685
Change view
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30198685 100 μl 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30198685 Fournisseur Invitrogen™ Code fournisseur RP91586

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54119 (PA5-54119. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q9P2J9
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 57546
Nom Human PDP2 (aa 416-486) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène [pyruvate dehydrogenase (acetyl-transferring)]-phosphatase; [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial; 4833426J09Rik; Gm1705; KIAA1348; mKIAA1348; PDP 2; PDP2; PDPC 2; PPM2B; PPM2C2; protein phosphatase 2 C, magnesium-dependent, catalytic subunit 2; protein phosphatase, Mg2+/Mn2+ dependent 2 B; pyruvate dehydrogenase [acetyl-transferring]-phosphatase 2, mitochondrial; pyruvate dehydrogenase phosphatase catalytic subunit 2; pyruvate dehydrogenase phosphatase isoenzyme 2; pyruvate dehydrogenase phosphatase, catalytic subunit 2; pyruvate dehyrogenase phosphatase catalytic subunit 2
Nom usuel PDP2
Symbole de gène(s) Pdp2
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence DMLSNEDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGE
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.