missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PSMB2 (aa 12-97) Control Fragment Recombinant Protein

Code produit 30198647
Change view
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30198647 100 μl 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30198647 Fournisseur Invitrogen™ Code fournisseur RP94169

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55305 (PA5-55305. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit has a trypsin-like activity.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P49721
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 5690
Nom Human PSMB2 (aa 12-97) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène AU045357; AW108089; C7-I; D4Wsu33e; HC7-I; Macropain subunit C7-I; multicatalytic endopeptidase complex subunit C7-1; multicatalytic endopeptidase complex subunit C7-I; proteasome (prosome, macropain) subunit, beta type 2; proteasome (prosome, macropain) subunit, beta type, 2; proteasome beta 2 subunit; proteasome component C7-I; proteasome subunit beta 2; proteasome subunit beta type-2; proteasome subunit, beta type, 2; PSMB2; testicular tissue protein Li 152
Nom usuel PSMB2
Symbole de gène(s) PSMB2
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence YVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTP
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.