missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30199175

Invitrogen™ Human SLC51B (aa 77-127) Control Fragment Recombinant Protein

Code produit 30199175
Change view
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30199175 100 μl 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30199175 Fournisseur Invitrogen™ Code fournisseur RP88590

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52574 (PA5-52574. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The heteromeric transporter OST Alpha/OST Beta facilitates the transport of bile and other steroid solutes across the basolateral epithelial cell membrane of intestine, liver, testis, kidney and adrenal gland. OST Alpha/OST Beta expression is induced by bile acids through ligand-dependent transactivation of their genes by FXR (Farnesoid X-activated receptor). This genetic regulation suggests that in response to changes in intracellular bile acid levels, bile acids adjust the rate of their own efflux from enterocytes. OST Beta is a 128 amino acid single-pass transmembrane protein that requires OST Alpha to localize to the plasma membrane. Coexpression of OST Alpha and OST Beta is also required to convert the OST Alpha subunit to a mature glycosylated endoglycosidase H-resistant form, suggesting that co-expression facilitates trafficking of OST Alpha through the golgi apparatus. Though widely expressed, OST Beta is present at highest levels in ileum.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q86UW2
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 123264
Nom Human SLC51B (aa 77-127) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène organic solute transporter beta; organic solute transporter beta subunit; organic solute transporter subunit beta; Ost beta; Ostb; Ostbeta; OST-beta; RGD1565748; Slc51b; solute carrier family 51 beta subunit; solute carrier family 51 subunit beta; solute carrier family 51, beta subunit
Nom usuel SLC51B
Symbole de gène(s) SLC51B
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence VLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETE
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.