missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30182478

Invitrogen™ Human SMPD4 (aa 596-699) Control Fragment Recombinant Protein

Code produit 30182478
Change view
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30182478 100 μl 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30182478 Fournisseur Invitrogen™ Code fournisseur RP98452

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61966 (PA5-61966. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by SMPD4 is a sphingomyelinase that catalyzes the hydrolysis of membrane sphingomyelin to form phosphorylcholine and ceramide. This gene is activated by DNA damage, cellular stress, and tumor necrosis factor, but it is downregulated by wild-type p53. The encoded protein localizes to the endoplasmic reticulum and Golgi network.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q9NXE4
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 55627
Nom Human SMPD4 (aa 596-699) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 4122402O22Rik; Kiaa1418; mKIAA1418; NET13; neutral membrane (neutral sphingomyelinase-3); neutral sphingomyelinase 3; Neutral sphingomyelinase III; neutral sphingomyelinase-3; NSMASE3; nSMase-3; RGD1310674; SKNY; SKNY protein; Smpd4; Sphingomyelin phosphodiesterase 4; sphingomyelin phosphodiesterase 4, neutral membrane; sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3)
Nom usuel SMPD4
Symbole de gène(s) SMPD4
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence LAQLITQAKHTAKSISDQCAESPAGHSFLSWLGFSSMDTNGSYTANDLDEMGQDSVRKTDEYLEKALEYLRQIFRLSEAQLRQFTLALGTTQDENGKKQLPDCI
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.