missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30194565

Invitrogen™ Human WSCD2 (aa 61-170) Control Fragment Recombinant Protein

Code produit 30194565
Change view
Click to view available options
Quantité:
100 μl
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantité unitSize
30194565 100 μl 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30194565 Supplier Invitrogen™ Supplier No. RP89984

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53046 (PA5-53046. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function remains known.
TRUSTED_SUSTAINABILITY

Specifications

Numéro d’adhésion Q2TBF2
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 9671
Nom Human WSCD2 (aa 61-170) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 4933413A10Rik; C530024P05Rik; Gm450; KIAA0789; MGC117165; si:ch211-240b21.1; WSC domain containing 2; WSC domain containing 2, pseudogene 1; WSC domain-containing protein 2; wscd2; Wscd2-ps1
Nom usuel WSCD2
Symbole de gène(s) WSCD2
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence GAELSFLGDMHLGRGFRDTGEASSIARRYGPWFKGKDGNERAKLGDYGGAWSRALKGRVVREKEEERAKYIGCYLDDTQSRALRGVSFFDYKKMTIFRCQDNCAERGYLY
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.