missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. YY2 Antibody - Azide and BSA Free, R&D Systems™

YY2 Antibody - Azide and BSA Free, R&D Systems™

Product Code. 18603160 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18603160 0.02 mL 0.02mL
18660751 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18603160 Supplier Novus Biologicals Supplier No. NBP2939050.02ml
 Restricted Item
Expédition estimée: 02-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

YY2 Polyclonal specifically detects YY2 in Human, Mouse, Rat samples. It is validated for ELISA, Immunocytochemistry/Immunofluorescence, Western Blot.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen YY2
Applications ELISA, Immunocytochemistry/Immunofluorescence, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias transcription factor YY2, YY2 transcription factor, ZNF631
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human YY2 (NP_996806.2). GEGQAENPPDYSEYLKGKKLPPGGLPGIDLSDPKQLAEFTKVKPKRSKGEPPKTVPCSYSGCEKMFRDYAAMRKHLHIHGPRVHVCAECGKAFLESSKLRR
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Endocrinology
Primary or Secondary Primary
Gene ID (Entrez) 404281
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.