missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. Abnova™ Human GATA4 Partial ORF (NP_002043.2, 343 a.a. - 442 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human GATA4 Partial ORF (NP_002043.2, 343 a.a. - 442 a.a.) Recombinant Protein with GST-tag at N-terminal

Code produit 16108554
Modifier l'affichage
Click to view available options
Quantité:
10 ug
25 ug
Conditionnement:
10µg
25µg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité Conditionnement
16108554 10 ug 10µg
16118554 25 ug 25µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 16108554 Fournisseur Abnova™ Code fournisseur H00002626Q01.10ug
 Article restreint
Ajouter au panier
Ajouter au panier

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. This protein is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function. Mutations in this gene have been associated with cardiac septal defects. [provided by RefSeq]

Sequence: ASGASSNSSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA

Spécification

Numéro d’adhésion NP_002043.2
À utiliser avec (application) Antibody Production, ELISA, Protein Array, Western Blot
Formule 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Identification génétique (Entrez) 2626
Poids moléculaire 36.74kDa
Nom GATA4 (Human) Recombinant Protein (Q01)
Test du contrôle qualité 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantité 10 ug
Immunogène ASGASSNSSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA
Conditions de stockage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
État réglementaire RUO
Alias de gène MGC126629
Nom usuel GATA4
Symbole de gène(s) GATA4
Espèces Wheat Germ (in vitro)
Recombinant Recombinant
Marqueur de protéine GST
Système d’expression wheat germ expression system
Forme Liquid
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.