missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ A1BG Recombinant Protein

Code produit. 16151141
Click to view available options
Quantité:
10 μg
25 μg
Conditionnement:
10µg
25µg
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 16151141

Marque: Abnova™ H00000001P01.10ug

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Human A1BG full-length ORF recombinant protein with GST-tag at N-terminal

The protein encoded by this gene is a plasma glycoprotein of unknown function. The protein shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.

  • Theoretical MW (kDa): 66.77
  • Preparation method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 fast flow
  • Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYRTDGEGALSEPSATVTIEELAAPPPPVLMHHGESSQVLHPGNKVTLTCVAPLSGVDFQLRRGEKELLVPRSSTSPDRIFFHLNAVALGDGGHYTCRYRLHDNQNGWSGDSAPVELILSDETLPAPEFS
PEPESGRALRLRCLAPLEGARFALVREDRGGRRVHRFQSPAGTEALFELHNISVADSANYSCVYVDLKPPFGGSAPSERLELHVDGPPPRPQLRATWSGAVLAGRDAVLRCEGPIPDVTFELLREGETKAVKTVRTPGAAANLELIFVGPQHAGNYRCRYRSWVPHTFESELSDPVELLVAES

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spécification

Numéro d’adhésion AAH35719
À utiliser avec (application) Antibody Production, Protein Array, ELISA, Western Blot
Formule 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Identification génétique (Entrez) 1
Poids moléculaire 66.77
Nom A1BG (Human) Recombinant Protein (P01)
Plage de pH 8
Méthode de préparation In vitro wheat germ expression system
Méthode de purification Glutathione Sepharose 4 Fast Flow
Test du contrôle qualité 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantité 10 μg
Source Wheat Germ (in vitro)
Conditions de stockage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gène A1B/ABG/DKFZp686F0970/GAB/HYST2477
Nom usuel A1BG
Symbole de gène(s) A1BG
Réactivité croisée Human
Espèces Wheat Germ (in vitro)
Recombinant Recombinant
Marqueur de protéine GST
Forme Solution
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis