missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ ADAMTS7 Recombinant Protein Antigen

Code produit 18186338 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0,1 ml
Conditionnement:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18186338 0,1 ml 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18186338 Fournisseur Novus Biologicals™ Code fournisseur NBP238539PEP

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADAMTS7. The ADAMTS7 Recombinant Protein Antigen is derived from E. coli. The ADAMTS7 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP2-38539. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Spécification

Gene ID (Entrez) 11173
Espèces Human
Méthode de purification Chromatography
Pureté >80%
Concentration 0.5mg/mL
Contenu et stockage Store at -20°C. Avoid freeze-thaw cycles.
Formule PBS and 1M Urea, pH 7.4.
À utiliser avec (application) Blocking/Neutralizing, Control
Symbole de gène(s) ADAMTS7
Type d’étiquette Unlabeled
Poids moléculaire 22kDa
Type de produit ADAMTS7
Quantité 0,1 ml
État réglementaire RUO
Source E.Coli
Réactivité spécifique This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38539. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogène LGRAHIRAHTPACHLLGEVQDSELEGGLAAISACDGLKGVFLLSN
Afficher plus Afficher moins

Usage exclusivement réservé à la recherche

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.