missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ AGR2 Recombinant Protein
Click to view available options
Quantité:
10 μg
25 μg
Conditionnement:
10µg
25µg
Description
- Encoded by anterior gradient homolog 2 gene
- Molecular weight: 44.99kDa
- Preparation method: in vitro wheat germ expression system
- Purification: glutathione sepharose 4 fast flow
- Storage buffer: 50 mM Tris-HCI, 10 mM reduced glutathione
- pH=8.0 in elution buffer
Sequence: MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Best when used within three months from the date of receipt.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Spécification
Spécification
| Numéro d’adhésion | AAH15503.1 |
| À utiliser avec (application) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formule | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Identification génétique (Entrez) | 10551 |
| Poids moléculaire | 44.99 |
| Nom | AGR2 (Human) Recombinant Protein (P01) |
| Plage de pH | 8 |
| Méthode de préparation | In vitro wheat germ expression system |
| Méthode de purification | Glutathione Sepharose 4 Fast Flow |
| Test du contrôle qualité | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Afficher plus |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu