Learn More
Abnova™ CDC42 (Human) Recombinant Protein (P01)
Description
The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants.
- Theoretical MW (kDa): 46.75
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Best use within three months from the date of receipt of this protein.
ELISA, Western Blot (Recombinant protein), Antibody Production, Protein Array
Spécification
Spécification
| À utiliser avec (application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formule | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Poids moléculaire | 46.75 |
| Nom | Human CDC42 Full-length ORF Recombinant Protein with GST-tag at N-terminal |
| Plage de pH | 8 |
| Méthode de préparation | In vitro wheat germ expression system |
| Méthode de purification | Glutathione Sepharose 4 Fast Flow |
| Test du contrôle qualité | 12.5% SDS-PAGE stained with Coomassie Blue |
| Quantité | 25μg |
| Source | Wheat Germ (in vitro) |
| Afficher plus |
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.