Abnova™ COX6B1 (Human) Recombinant Protein

Human COX6B1 full-length ORF ( AAH01015, 1 a.a. - 86 a.a.) recombinant protein with GST-tag at N-terminal.

Marque: Abnova™ H00001340-P01.10ug

Code produit. 16113431

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Sequence: MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI

Spécification

Numéro d’adhésion	AAH01015
Nom	cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous)
Test du contrôle qualité	125% SDS-PAGE Stained with Coomassie Blue
Conditions de stockage	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Symbole de gène(s)	COX6B1
Marqueur de protéine	GST

Identification génétique (Entrez)	1340
Méthode de préparation	Wheat germ expression system
Quantité	10 μg
Alias de gène	COX6B, COXG
Espèces	Wheat Germ (in vitro)
Tampon	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Suggestions de produits

Description