missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. Abnova™ EIF4EBP1 (Human) Recombinant Protein

Abnova™ EIF4EBP1 (Human) Recombinant Protein

Product Code. 16104441
missing translation for 'orderingAttributeHoverText'
Quantité:
10 μg
25 μg
missing translation for 'unitSize'
10µg
25µg
This item is not returnable. View return policy

Product Code. 16104441

missing translation for 'mfr': Abnova™ H00001978P01.10ug

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

This item is not returnable. View return policy

Description

Human EIF4EBP1 full-length ORF ( AAH04459, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.

  • Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Specifications

Numéro d’adhésion AAH04459
Identification génétique (Entrez) 1978
Nom eukaryotic translation initiation factor 4E binding protein 1
Méthode de préparation Wheat germ expression system
Test du contrôle qualité 125% SDS-PAGE Stained with Coomassie Blue
Quantité 10 μg
Conditions de stockage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gène 4E-BP1, 4EBP1, BP-1, MGC4316, PHAS-I
Symbole de gène(s) EIF4EBP1
Espèces Wheat Germ (in vitro)
Marqueur de protéine GST
Tampon 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.