Abnova™ EIF4EBP1 (Human) Recombinant Protein

Name: Abnova&trade; EIF4EBP1 (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16104441
Price: 335.00 EUR

Human EIF4EBP1 full-length ORF ( AAH04459, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.

Marque: Abnova™ H00001978-P01.10ug

Informations supplémentaires : Poids : 0.00010kg

Code produit. 16104441

Expédition estimée: 03-05-2023
pour voir le stock disponible

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Description

Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Spécification

Numéro d’adhésion	AAH04459
Nom	eukaryotic translation initiation factor 4E binding protein 1
Test du contrôle qualité	125% SDS-PAGE Stained with Coomassie Blue
Conditions de stockage	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Symbole de gène(s)	EIF4EBP1
Marqueur de protéine	GST

Identification génétique (Entrez)	1978
Méthode de préparation	Wheat germ expression system
Quantité	10 μg
Alias de gène	4E-BP1, 4EBP1, BP-1, MGC4316, PHAS-I
Espèces hôtes	Wheat Germ (in vitro)
Tampon	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Description