missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Réactifs biochimiques
  4. Peptides
  5. 18314501

Novus Biologicals™ GNIP Recombinant Protein Antigen

Code produit 18314501 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0,1 ml
Conditionnement:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantité unitSize
18314501 0,1 ml 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18314501 Supplier Novus Biologicals™ Supplier No. NBP189751PEP

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

This item is not returnable. View return policy

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRIM7. The GNIP Recombinant Protein Antigen is derived from E. coli. The GNIP Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-89751. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifications

Gene ID (Entrez) 81786
Espèces Human
Méthode de purification Chromatography
Pureté >80%
Concentration 0.5mg/mL
Contenu et stockage Store at -20°C. Avoid freeze-thaw cycles.
Formule PBS and 1M Urea, pH 7.4.
À utiliser avec (application) Blocking/Neutralizing, Control
Symbole de gène(s) TRIM7
Type d’étiquette Unlabeled
Poids moléculaire 28kDa
Type de produit GNIP
Quantité 0,1 ml
État réglementaire RUO
Source E.Coli
Réactivité spécifique This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89751. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogène LRVLKKELEDCEVFRSTEKKESKELLKQMAAEQEKVGAEFQALRAFLVEQEGRLLGRLEELSREVAQKQNENLAQLGVEITQLSKLSSQI
Show More Show Less

Usage exclusivement réservé à la recherche

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.