missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ HIST1H2BC Recombinant Protein
Spécification
| Numéro d’adhésion | AAH09612 |
|---|---|
| À utiliser avec (application) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formule | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Identification génétique (Entrez) | 8347 |
| Poids moléculaire | 39.6 |
Description
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Spécification
| AAH09612 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 39.6 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| HIST1H2BC | |
| Human | |
| Recombinant | |
| Solution |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 8347 | |
| HIST1H2BC (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK | |
| H2B.1/H2B/l/H2BFL/MGC104246/dJ221C16.3 | |
| HIST1H2BC | |
| Wheat Germ (in vitro) | |
| GST |