missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30196921

Invitrogen™ Human A4GALT (aa 45-145) Control Fragment Recombinant Protein

Code produit. 30196921
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30196921

Marque: Invitrogen™ RP108091

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67429 (PA5-67429. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system. The encoded protein, which is a type II membrane protein found in the Golgi, is also required for the synthesis of the bacterial verotoxins receptor.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q9NPC4
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 53947
Nom Human A4GALT (aa 45-145) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène A14GALT; A4GALT; A4galt {ECO:0000312; A4GALT1; alpha 1,4-galactosyltransferase; alpha 14-galactosyltransferase; alpha-1,4-galactosyltransferase; Alpha-1,4-N-acetylglucosaminyltransferase; alpha4Gal-T1; cd77; CD77 synthase; Gb3; Gb3 synthase; Gb3/CD77 synthase; Gb3S; Globotriaosylceramide synthase; lac; lactosylceramide 4-alpha-galactosyltransferase; P blood group (P one antigen); P(k); P(k) antigen synthase; P1; P1/Pk. synthase; P1PK; Pk.; RGD:621583}; truncated alpha 1,4-galactosyltransferase; UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase
Nom usuel A4GALT
Symbole de gène(s) A4galt
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence EPKEKGQLYNLPAEIPCPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLD
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis