missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30181842

Invitrogen™ Human ABAT (aa 148-236) Control Fragment Recombinant Protein

Code produit. 30181842
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30181842

Marque: Invitrogen™ RP98785

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111137 (PA5-111137. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P80404
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 18
Nom Human ABAT (aa 148-236) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène (S)-3-amino-2-methylpropionate transaminase; 4-aminobutyrate aminotransferase; 4-aminobutyrate aminotransferase, brain isoform; 4-aminobutyrate aminotransferase, liver isoform; 4-aminobutyrate aminotransferase, mitochondrial; 4-aminobutyrate transaminase; 9630038C02Rik; ABAT; AI255750; beta-AlaAT; beta-alanine oxoglutarate aminotransferase; cb880; ENSMUSG00000051226; fj82a01; FLJ17813; FLJ30272; GABA aminotransferase; GABA AT; GABA T; GABA transaminase; GABA transferase; Gabaat; GABA-AT; Gabat; GABA-T; Gamma-amino-N-butyrate transaminase; Gm9851; hCG1984265; I54; L AIBAT; Laibat; L-AIBAT; mitochondrial 4-aminobutyrate aminotransferase; NPD009; wu:fj82a01; X61497
Nom usuel ABAT
Symbole de gène(s) ABAT
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence LSVAPKGMSQLITMACGSCSNENALKTIFMWYRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKI
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis