missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30181360

Invitrogen™ Human Adenylate Kinase 4 (aa 164-194) Control Fragment Recombinant Protein

Code produit. 30181360
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30181360

Marque: Invitrogen™ RP99815

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61978 (PA5-61978. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P27144
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 205
Nom Human Adenylate Kinase 4 (aa 164-194) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène adenylate kinase 3 alpha-like 1; Adenylate kinase 3-like; adenylate kinase 3-like {ECO:0000255; adenylate kinase 3-like 1; adenylate kinase 3-like 2; adenylate kinase 4; adenylate kinase 4, mitochondrial; adenylate kinase 4, mitochondrial {ECO:0000255; Adenylate kinase isoenzyme 4; adenylate kinase isoenzyme 4, mitochondrial; adenylate kinase isoenzyme 4, mitochondrial; adenylate kinase 4, mitochondrial; AK 4; AK 4 {ECO:0000255; AK3; Ak-3; Ak3b; Ak3l1; AK3L2; AK4; Ak-4; ATP-AMP transphosphorylase; D4Ertd274e; GTP:AMP phosphotransferase AK4; GTP:AMP phosphotransferase AK4 {ECO:0000255; GTP:AMP phosphotransferase AK4, mitochondrial; HAMAP-Rule:MF_03170}; mitochondrial adenylate kinase-3; nucleoside-triphosphate-adenylate kinase; RP4-686B20.1
Nom usuel Adenylate Kinase 4
Symbole de gène(s) AK4
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence PEAVAARLRQYKDVAKPVIELYKSRGVLHQF
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis