missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30204710

Invitrogen™ Human AKIP1 (aa 13-74) Control Fragment Recombinant Protein

Code produit. 30204710
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30204710

Marque: Invitrogen™ RP107059

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66385 (PA5-66385. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Enhances NF-kappa-B transcriptional activity by regulating the nuclear localization of the NF-kappa-B subunit RELA and promoting the phosphorylation of RELA by PRKACA. Regulates the effect of the cAMP-dependent protein kinase signaling pathway on the NF-kappa-B activation cascade.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q9NQ31
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 56672
Nom Human AKIP1 (aa 13-74) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène A kinase (PRKA) interacting protein 1; A-kinase interacting protein 1; A-kinase-interacting protein 1; Akip1; BCA3; breast cancer associated 3; breast cancer associated gene 3; breast cancer-associated gene 3 protein; C11orf17; D7H11orf17; D930014E17Rik; ICRFP703B1614Q5.6; ICRFP703N2430Q5.6; koyt binding protein 1; koyt binding protein 2; koyt binding protein 3; ORF27; Pk.-interacting protein; Proline-rich protein BCA3; protein kinase A-interacting protein 1; RGD1306959
Nom usuel AKIP1
Symbole de gène(s) Akip1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence VDRRSLQRSARLALEVLERAKRRAVDWHALERPKGCMGVLAREAPHLEKQPAAGPQRVLPGE
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis