missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30196489

Invitrogen™ Human ANP (aa 91-148) Control Fragment Recombinant Protein

Code produit. 30196489
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30196489

Marque: Invitrogen™ RP109056

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the natriuretic peptide family. Natriuretic peptides are implicated in the control of extracellular fluid volume and electrolyte homeostasis. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. Mutations in this gene have been associated with atrial fibrillation familial type 6.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P01160
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 4878
Nom Human ANP (aa 91-148) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène Anf; ANP; ATFB6; atrial natriuretic factor; Atrial natriuretic peptide; atriopeptin; Atriopeptin I; Atriopeptin II; Atriopeptin III; Atriopeptin-1; Atriopeptin-2; Atriopeptin-3; ATRST2; Auriculin-A; Auriculin-B; Cardiodilatin; Cardiodilatin-related peptide; cardionatrin; CDD; CDD-ANF; CDP; natriuretic peptide A; Natriuretic peptide precursor A (pronatriodilatin, also Anf, Pnd); natriuretic peptide precursor A variant 1; natriuretic peptide precursor A variant NPPA-M1; natriuretic peptide precursor A variant NPPA-M2; natriuretic peptide precursor A variant NPPA-M3; natriuretic peptide precursor type A; natriuretic peptide type A; natriuretic peptides A; Nppa; Pnd; Prepronatriodilatin; Pronatriodilatin; RATANF; urodilatin
Nom usuel ANP
Symbole de gène(s) NPPA
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence QRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNS
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis