missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30208641

Invitrogen™ Human ANR44 (aa 473-528) Control Fragment Recombinant Protein

Code produit. 30208641
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30208641

Marque: Invitrogen™ RP95964

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56352 (PA5-56352. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Putative regulatory subunit of protein phospatase 6 (PP6) that may be involved in the recognition of phosphoprotein substrates.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q8N8A2
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 91526
Nom Human ANR44 (aa 473-528) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène ANKRD44; ankyrin repeat domain 44; ankyrin repeat domain-containing protein 44; PP6-ARS-B; protein phosphatase 6 ankyrin repeat subunit B; serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B; serine/threonine-protein phosphatase 6 regulatory subunit ARS-B
Nom usuel ANR44
Symbole de gène(s) ANKRD44
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence TALHYAAASDMDRNKTILGNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIR
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis