missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30197133

Invitrogen™ Human ATP Citrate Lyase (aa 116-212) Control Fragment Recombinant Protein

Code produit. 30197133
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30197133

Marque: Invitrogen™ RP93260

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82799 (PA5-82799. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP citrate lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. The enzyme is a tetramer (relative molecular weight approximately 440,000) of apparently identical subunits. It catalyzes the formation of acetyl-CoA and oxaloacetate from citrate and CoA with a concomitant hydrolysis of ATP to ADP and phosphate. The product, acetyl-CoA, serves several important biosynthetic pathways, including lipogenesis and cholesterogenesis. In nervous tissue, ATP citrate-lyase may be involved in the biosynthesis of acetylcholine. Two transcript variants encoding distinct isoforms have been identified for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Numéro d’adhésion P53396
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 47
Nom Human ATP Citrate Lyase (aa 116-212) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 17-beta-HSD 10; 17-beta-hydroxysteroid dehydrogenase 10; 17 bHSD10; 17 b-HSD10; 2-methyl-3-hydroxybutyryl-CoA dehydrogenase; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3-hydroxyacyl-CoA dehydrogenase type-2; A730098H14Rik; ABAD; AB-binding alcohol dehydrogenase; ACL; ACLY; Ads9; amyloid beta-peptide binding protein; amyloid-beta peptide binding alcohol dehydrogenase; ATP citrate lyase; ATP-citrate (pro-S-)-lyase; ATP-citrate synthase; ATPCL; AW538652; CAMR; citrate cleavage enzyme; CLATP; DUPXp11.22; endoplasmic reticulum-associated amyloid beta-peptide-binding protein; ERAB; HADH2; HCD2; Hsd17b10; hydroxyacyl-Coenzyme A dehydrogenase type II; hydroxyacyl-Coenzyme A dehydrogenase, type II; hydroxysteroid (17-beta) dehydrogenase 10; hydroxysteroid 17-beta dehydrogenase 10; hydroxysteroid dehydrogenase 10; MHBD; Mitochondrial ribonuclease P protein 2; mitochondrial RNase P protein 2; mitochondrial RNase P subunit 2; MRPP2; MR x 17; MR x 31; MRXS10; SCHAD; SDR5C1; short chain dehydrogenase/reductase family 5 C member 1; short chain dehydrogenase/reductase family 5 C, member 1; short chain L-3-hydroxyacyl-CoA dehydrogenase; short chain L-3-hydroxyacyl-CoA dehydrogenase type 2; short chain type dehydrogenase/reductase XH98G2; Short-chain type dehydrogenase/reductase XH98G2; Type II HADH; XH98G2
Nom usuel ATP Citrate Lyase
Symbole de gène(s) Acly
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence AEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGV
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.