missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30206915

Invitrogen™ Human BIKE (aa 683-764) Control Fragment Recombinant Protein

Code produit. 30206915
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30206915

Marque: Invitrogen™ RP95067

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55308 (PA5-55308. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The phosphorylation and dephosphorylation of proteins on serine and threonine residues is an essential means of regulating a broad range of cellular functions in eukaryotes, including cell division, homeostasis and apoptosis. A group of proteins that are intimately involved in this process are the serine/threonine (Ser/Thr) protein kinases. BMP2K (BMP2 inducible kinase), also known as BIKE, is a 1,161 amino acid nuclear protein that contains one protein kinase domain and belongs to the Ser/Thr protein kinase family. Thought to be involved in osteoblast differentiation, BMP2K catalyzes the ATP-dependent phosphorylation of bone morphogenic proteins (BMPs); proteins that are essential for proper cartilage and bone formation. Via its catalytic activity, BMP2K may play a role in signaling pathways that mediate bone growth and cellular differentiation. Three isoforms of BMP2K exist due to alternative splicing events.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q9NSY1
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 55589
Nom Human BIKE (aa 683-764) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 4933417M22Rik; AA673486; AV128808; BIKE; Bike kinase; BMP2 inducible kinase; BMP-2 inducible kinase; BMP-2-inducible protein kinase; Bmp2k; HRIHFB2017
Nom usuel BIKE
Symbole de gène(s) BMP2K
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence FISHSGSPEKKAEHSSINQENGTANPIKNGKTSPASKDQRTGKKTSVQGQVQKGNDESESDFESDPPSPKSSEEEEQDDEEV
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis