Abnova™ Human C9orf103 Partial ORF (NP_001001551, 41 a.a. - 141 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marque: Abnova™ H00414328-Q01.10ug

Code produit. 16152987

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Sequence: KKTYRDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSGSFEVISGRLLKREGHFMPPELLQSQFETLEPPAAPENFIQISVDKNVSEIIATIMETLKMK

Spécification

Numéro d’adhésion	NP_001001551
Formule	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Poids moléculaire	36.85kDa
Test du contrôle qualité	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogène	KKTYRDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSGSFEVISGRLLKREGHFMPPELLQSQFETLEPPAAPENFIQISVDKNVSEIIATIMETLKMK
État réglementaire	RUO
Nom usuel	C9orf103
Espèces	Wheat Germ (in vitro)
Marqueur de protéine	GST
Forme	Liquid

À utiliser avec (application)	Antibody Production, ELISA, Protein Array, Western Blot
Identification génétique (Entrez)	414328
Nom	C9orf103 (Human) Recombinant Protein (Q01)
Quantité	10 ug
Conditions de stockage	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gène	bA522I20.2
Symbole de gène(s)	C9orf103
Recombinant	Recombinant
Système d’expression	wheat germ expression system

Suggestions de produits

Description