missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CCR7 (aa 25-58) Control Fragment Recombinant Protein

Code produit. 30201734
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30201734

Marque: Invitrogen™ RP108001

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111719 (PA5-111719. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CCR7 is a member of the G protein coupled receptor family, which is a subfamily of chemokines. CCR7 was identified to be induced by the Epstein Barr virus (EBV), and is thought to be a mediator of EBV effects on B lymphocytes. CCR7 has been reported to be expressed in blood, bone marrow, lymph node, and intestine. CCR7 is particularly expressed in lymphoid tissues and in activated B and T lymphocytes and has been shown to control the migration of memory T cells to inflamed tissues, as well as stimulate dendritic cell maturation. The chemokine (C-C motif) ligand 19 (CCL19/ECL) has been reported to be a specific ligand of this receptor. ESTs have been isolated from blood, embryo, lymph node, and thymus libraries. Receptors for the C - C chemokine family include CCR 1, CCR 2A, CCR 3, CCR 4, CCR 5 and the Duffy blood group antigen. The C-C receptors are important in the function of T cell chemotaxis and migration of phagocytic cells to sites of inflammation.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P32248
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 1236
Nom Human CCR7 (aa 25-58) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène BLR2; Bukitt's lymphoma receptor 2; CC chemokine receptor 7; C-C chemokine receptor type 7; C-C CKR-7; C-C motif chemokine receptor 7; CC-CKR-7; CCR7; CCR-7; CD197; CDw197; chemokine (C-C motif) receptor 7; chemokine (C-C) receptor 7; Cmkbr7; EBI1; Ebi1h; EBV-induced G protein-coupled receptor 1; EBV-induced G-protein coupled receptor 1; Epstein-Barr virus induced gene 1; Epstein-Barr virus-induced G-protein coupled receptor 1; EVI1; lymphocyte-specific G protein-coupled peptide receptor; MIP-3 beta receptor
Nom usuel CCR7
Symbole de gène(s) Ccr7
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence QDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKA
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis