missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30204298

Invitrogen™ Human CD137 (aa 115-188) Control Fragment Recombinant Protein

Produktkod. 30204298
Klicka för att se tillgängliga alternativ
Quantité:
100 μl
Förpackningsstorlek:
100µL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30204298

Brand: Invitrogen™ RP107815

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111675 (PA5-111675. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD137, also known as TNFRSF9 or 4-1BB, is an inducible costimulatory molecule expressed mainly on activated T cells. Its ligand, known as 4-1BBL, is expressed on activated macrophages, mature B cells, hematopoietic stem cells, and myeloid progenitor cells. CD137 signaling leads to maintaining the survival of activated T cells and CD8+ memory T cells, and clonal expansion of T cells, but also to suppressing myelopoiesis and dendritic cell development. Triggered CD137 induces a cytokine release profile regulating peripheral monocyte survival. Soluble forms of CD137 may provide negative control mechanism for some immune responses.
TRUSTED_SUSTAINABILITY

Specifikationer

Numéro d’adhésion Q07011
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 3604
Nom Human CD137 (aa 115-188) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 4 1 BB; 41 BB; 4-1 BB; 4-1 BB ligand receptor; A930040I11Rik; AA408498; AI325004; Cd137; CD137 antigen; CDw137; EGK_00183; homolog of mouse 4-1 BB; ILA; induced by lymphocyte activation (ILA); interleukin-activated receptor, homolog of mouse Ly63; Ly63; receptor protein 4-1 BB; s4 1 BB; s4 1 BB; s41BB; sCD137; secreted CD137 antigen; soluble 4 1 BB; soluble 4 1 BB; soluble 41 BB; soluble CD137; T cell antigen ILA; T-cell antigen 4-1 BB; T-cell antigen 4-1 BB homolog; T-cell antigen ILA; TNF receptor superfamily member 9; TNFRSF9; Tumor necrosis factor receptor superfamily member 9; tumor necrosis factor receptor superfamily, member 9
Nom usuel 4-1 BB (CD137)
Symbole de gène(s) TNFRSF9
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence KGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQII
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.