missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CD63 (aa 108-196) Control Fragment Recombinant Protein

Code produit. 30193647
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30193647

Marque: Invitrogen™ RP90638

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82391 (PA5-82391. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD63 (LAMP-3, lysosome-associated membrane protein-3), a glycoprotein of tetraspanin family, is present in late endosomes, lysosomes and secretory vesicles of various cell types. CD63 is also present in the plasma membrane, usually following cell activation. Hence, CD63 has become a widely used basophil activation marker. In mast cells, however, CD63 exposition does not need their activation. CD63 interacts with integrins and affects phagocytosis and cell migration, it is also involved in H/K-ATPase trafficking regulation of ROMK1 channels. CD63 also serves as a T-cell costimulation molecule. Expression of CD63 can be used for predicting the prognosis in earlier stages of carcinomas. CD63 is expressed on activated platelets, and is a lysosomal membrane glycoprotein that is translocated to plasma membrane after platelet activation. CD63 is also present in monocytes and macrophages and is weakly expressed on granulocytes, B, and T cells. CD63 is identical to the melanoma-associated antigen which is ME491 and to the platelet antigen PTLGP40. Diseases associated with CD63 dysfunction include melanoma and Hermansky-Pudlak Syndrome.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P08962
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 967
Nom Human CD63 (aa 108-196) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène C75951; CD 63; Cd63; CD63 antigen; CD63 antigen (melanoma 1 antigen); Cd63 molecule; CD63 protein; granulophysin; LAMP-3; Lysosomal-associated membrane protein 3; lysosome-associated membrane glycoprotein 3; mast cell antigen AD1; ME491; melanoma 1 antigen; melanoma-associated antigen ME491; melanoma-associated antigen MLA1; MLA1; Ocular melanoma-associated antigen; OMA81H; Tetraspanin-30; TSPAN30; tspan-30
Nom usuel CD63
Symbole de gène(s) CD63
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence RDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIG
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis