missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CDCA8 (aa 202-280) Control Fragment Recombinant Protein

Code produit. 30211470
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30211470

Marque: Invitrogen™ RP94216

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55978 (PA5-55978. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDCA8 is a component of a chromosomal passenger complex (CPC) required for stability of the bipolar mitotic spindle. The chromosomal passenger complex, which includes Survivin, CDCA8, INCENP and Aurora-B, is known to play crucial roles during mitosis and cell division. It was found that CDCA8 interacting with Aurora-B, INCENP and Survivin, increases during G2/M phase and then reduces after exit from M phase. CDCA8 is cell cycle regulated, down-regulated in response to p53/Rb-signaling, and up-regulated in many types of cancerous tissues. In Drosophila cells, inactivation of CDCA8 results in polyploidy, delayed mitosis and abnormal tissue development, indicating its critical role for cell proliferation. Recent studies show that CDCA8 is essential for cell proliferation during early embryonic development, and its early embryonic lethality cannot be rescued by the loss of p53. Its aberrant expression is linked to a poor prognosis for gastric cancer.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q53HL2
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 55143
Nom Human CDCA8 (aa 202-280) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 4831429J16Rik; AU044747; BOR; Borealin; Cdca8; cell division cycle associated 8; cell division cycle-associated protein 8; D4Ertd421e; Dasra B; DasraB; dasra-B; embryonic stem cell-related; hDasra-B; MESrg; MESRGP; PESCRG3; Pluripotent embryonic stem cell-related gene 3 protein
Nom usuel CDCA8
Symbole de gène(s) CDCA8
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence LRTPAAGERIYNISGNGSPLADSKEIFLTVPVGGGESLRLLASDLQRHSIAQLDPEALGNIKKLSNRLAQICSSIRTHK
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis