missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30194436

Invitrogen™ Human CIRH1A (aa 8-89) Control Fragment Recombinant Protein

Code produit. 30194436
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30194436

Marque: Invitrogen™ RP106044

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111179 (PA5-111179. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CIRH1A encodes a WD40-repeat-containing protein that is localized to the nucleolus. Mutation of this gene causes North American Indian childhood cirrhosis, a severe intrahepatic cholestasis that results in transient neonatal jaundice, and progresses to periportal fibrosis and cirrhosis in childhood and adolescence.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q969X6
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 84916
Nom Human CIRH1A (aa 8-89) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène CIRH1A; Cirhin; cirrhosis, autosomal recessive 1 A (cirhin); cirrhosis, autosomal recessive 1 A (human); cPERP-E; Kiaa1988; Naic; Teg-292; testis expressed gene 292; testis-expressed gene 292; testis-expressed gene 292 protein; Te x 292; U3 small nucleolar RNA-associated protein 4 homolog; UTP4; UTP4 small subunit (SSU) processome component; UTP4 small subunit processome component; UTP4, small subunit (SSU) processome component, homolog; UTP4, small subunit processome component
Nom usuel CIRH1A
Symbole de gène(s) UTP4
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence RVRFFNYVPSGIRCVAYNNQSNRLAVSRTDGTVEIYNLSANYFQEKFFPGHESRATEALCWAEGQRLFSAGLNGEIMEYDLQ
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis