missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30205606

Invitrogen™ Human COH1 (aa 250-319) Control Fragment Recombinant Protein

Code produit. 30205606
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30205606

Marque: Invitrogen™ RP104778

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65371 (PA5-65371. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

COH1 (Cohen syndrome protein 1), also known as VPS13B (vacuolar protein sorting-associated protein 13B) or CHS1, belongs to the VPS13 family and may function in vesicle-mediated transport and sorting of proteins within the cell. COH1 is widely expressed and multiple alternatively spliced transcript variants have been observed. Mutations in this gene have been associated with Cohen syndrome. COH1 is a Golgi-localized peripheral membrane protein and plays a critical role in Golgi (re)assembly.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q7Z7G8
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 157680
Nom Human COH1 (aa 250-319) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 1810042B05Rik; 2310042E16Rik; 4732488H20; C330002D13Rik; C87206; CHS1; COH1; Cohen syndrome homolog 1; Cohen syndrome protein 1; Cohen syndrome protein 1 homolog; D230005K13; KIAA0532; mKIAA0532; mKIAA5032; vacuolar protein sorting 13 homolog B; vacuolar protein sorting 13 B (yeast); vacuolar protein sorting-associated protein 13 B; Vps13b
Nom usuel COH1
Symbole de gène(s) VPS13B
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence PSVIKIHTLVESLKLSITDQQLPMFIRIMQLGIALYYGEIGNFKEGEIEDLTCHNKDMLGNITGSEDETR
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis