missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30200493

Invitrogen™ Human CPI-17 (aa 39-91) Control Fragment Recombinant Protein

Code produit. 30200493
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. View return policy

Product Code. 30200493

missing translation for 'mfr': Invitrogen™ RP102920

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83590 (PA5-83590. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CPI-17 is a phosphorylation-dependent inhibitory protein for smooth muscle myosin phosphate. CPI-17 was originally identified as a PKC-potentiated inhibitory protein of protein phosphatase-1, which is dominantly expressed in smooth muscle. Phosphorylation at Threonine 38, in vitro, by PKC or Rho-kinase enhances the inhibitory potency toward myosin phosphatase. CPI-17 is also phosphorylated at Threonine 38 by protein kinase N and might be involved in the calcium sensitization of smooth muscle contraction as a downstream effector of Rho and/or arachidonic acid. CPI-17 is dually phosphorylated at Serine 12 and Threonine 38 by a MYPT-associated kinase, M110 kinase.
TRUSTED_SUSTAINABILITY

Specifications

Numéro d’adhésion Q96A00
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 94274
Nom Human CPI-17 (aa 39-91) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 1110001M11Rik; 17 kDa PKC-potentiated inhibitory protein of PP1; 17-kDa PKC-potentiated inhibitory protein of PP1; 17-KDa protein; Cpi; CPI17; CPI-17; PKC-potentiated inhibitory protein of PP1; PPP1INL; PPP1R14A; Protein kinase C-potentiated inhibitor protein of 17 kDa; protein phosphatase 1 regulatory inhibitor subunit 14 A; protein phosphatase 1 regulatory subunit 14 A; protein phosphatase 1, regulatory (inhibitor) subunit 14 A
Nom usuel CPI-17
Symbole de gène(s) PPP1R14A
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence VKYDRRELQRRLDVEKWIDGRLEELYRGMEADMPDEINIDELLELESEEERSR
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.