missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Cyclin B1 (aa 91-163) Control Fragment Recombinant Protein

Code produit. 30193765
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30193765

Marque: Invitrogen™ RP104614

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83153 (PA5-83153. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cyclins bind to and regulate the activity of the Cyclin dependent protein kinases (CDKs). Cyclin B1 or CCNB1 is a regulatory protein involved in mitosis. It is essential for the control of the cell cycle at the G2/M transition. Cyclin B1 complexes with p34 (cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase. Cyclin B1 is not ubiquitinated during G2/M phase, resulting in its steady accumulation during G2 phase, followed by abrupt APC dependent destruction at the end of mitosis. Destruction of Cyclin B1 is required for cell cycle progression. Cyclin B1 is overexpressed in various cancers, including breast, prostate, and non-small cell lung cancer.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P14635
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 891
Nom Human Cyclin B1 (aa 91-163) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène Ccn-2; CCNB; Ccnb1; Ccnb1-rs1; Ccnb1-rs13; Cycb; Cycb1; Cycb1-rs1; Cycb-4; Cycb-5; cyclin B; cyclin B1; cyclin B1, related sequence 1; cyclin B1, related sequence 13; G2/mitotic-specific cyclin B1; G2/mitotic-specific cyclin-B1; I79_013589; OTTHUMP00000221981; OTTHUMP00000223023
Nom usuel Cyclin B1
Symbole de gène(s) Ccnb1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence PVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGAD
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis