Abnova™ Human DELGEF Partial ORF (NP_036271, 240 a.a. - 337 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marque: Abnova™ H00026297-Q01.25ug

Code produit. 16125476

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Sequence: KHGQLANEAAFLPVPQKIEAHCFQNEKVTAIWSGWTHLVAQTETGKMFTWGRADYGQLGRKLETYEGWKLEKQDSFLPCSRPPNSMPSSPHCLTGATE

Spécification

Numéro d’adhésion	NP_036271
Formule	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Poids moléculaire	36.52kDa
Test du contrôle qualité	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogène	KHGQLANEAAFLPVPQKIEAHCFQNEKVTAIWSGWTHLVAQTETGKMFTWGRADYGQLGRKLETYEGWKLEKQDSFLPCSRPPNSMPSSPHCLTGATE
État réglementaire	RUO
Nom usuel	SERGEF
Espèces	Wheat Germ (in vitro)
Marqueur de protéine	GST
Forme	Liquid

À utiliser avec (application)	Antibody Production, ELISA, Protein Array, Western Blot
Identification génétique (Entrez)	26297
Nom	DELGEF (Human) Recombinant Protein (Q01)
Quantité	25 ug
Conditions de stockage	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gène	DELGEF/Gnefr
Symbole de gène(s)	SERGEF
Recombinant	Recombinant
Système d’expression	wheat germ expression system

Suggestions de produits

Description