missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30196294

Invitrogen™ Human DNAH12 (aa 2350-2449) Control Fragment Recombinant Protein

Code produit. 30196294
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30196294

Marque: Invitrogen™ RP103320

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63534 (PA5-63534. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNAH12 gene ontology annotations related to this gene include microtubule-based movement.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q6ZR08
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 201625
Nom Human DNAH12 (aa 2350-2449) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 4921531P07Rik; axonemal beta dynein heavy chain 12; Axonemal dynein heavy chain 12-like protein; Axonemal dynein heavy chain 7-like protein; axonemal dynein heavy chain isotype3; Bm259; ciliary dynein heavy chain 12; DHC3; DLP12; Dnah12; DNAH12L; DNAH7L; DNAHC12; Dnahc3; Dnahc7c; Dnahc7l; DNHD2; dynein axonemal heavy chain 12; dynein heavy chain 12, axonemal; dynein heavy chain 12, axonemal-like; Dynein heavy chain 7-like, axonemal; dynein heavy chain domain 2; dynein heavy chain domain-containing protein 2; dynein, axonemal, heavy chain 12; dynein, axonemal, heavy polypeptide 12; dynein, heavy chain-5; Gm284; Gm74; Gm907; Hdhc3; HL19; HL-19
Nom usuel DNAH12
Symbole de gène(s) DNAH12
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence LLCANLLLARKEIEYQELMFLLTGGVSLKSAEKNPDPTWLQDKSWEEICRASEFPAFRGLRQHFCEHIYEWREIYDSKEPHNAKFPAPMDKNLNELQKII
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis