missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human FGFBP2 (aa 110-180) Control Fragment Recombinant Protein

Code produit. 30208981
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30208981

Marque: Invitrogen™ RP96652

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (31%), Rat (31%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58686 (PA5-58686. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in the amount of gene product may be associated with atopic asthma and mild extrinsic asthma.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q9BYJ0
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 83888
Nom Human FGFBP2 (aa 110-180) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 37 kDa killer-specific secretory protein; FGF-binding protein 2; FGFBP2; FGF-BP2; FGFBP-2; fibroblast growth factor binding protein 2; fibroblast growth factor-binding protein 2; HBp17-related protein; HBP17RP; HBp17-RP; killer-specific secretory protein of 37 kDa; KSP37; UNQ425/PRO1065
Nom usuel FGFBP2
Symbole de gène(s) FGFBP2
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence PVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTR
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis